PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004485623.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 245aa    MW: 28091.2 Da    PI: 9.6496
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004485623.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.86.6e-291059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    ri+n++ rqvtfskRrng+lKKA+ELS+LCdaev +i+fsstgkly+yss
  XP_004485623.1 10 RIDNSTSRQVTFSKRRNGLLKKAKELSILCDAEVGLIVFSSTGKLYDYSS 59
                    8***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.338161IPR002100Transcription factor, MADS-box
SMARTSM004324.9E-41160IPR002100Transcription factor, MADS-box
CDDcd002651.48E-45277No hitNo description
SuperFamilySSF554553.53E-33287IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-29323IPR002100Transcription factor, MADS-box
PfamPF003199.9E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-293859IPR002100Transcription factor, MADS-box
PfamPF014861.1E-2584170IPR002487Transcription factor, K-box
PROSITE profilePS5129715.17286176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MGRGKIAIRR IDNSTSRQVT FSKRRNGLLK KAKELSILCD AEVGLIVFSS TGKLYDYSST  60
SMKSIIERYN KQKEEQHHLM NPASEVKFWQ TEAASLRQQL QYLEESHRQL MGEGLSGLGI  120
KELQNLENQL DMSLKGVRMK KDHILTYEIK ELHQKGNLAH QENVELHKKM EIIQKENAEL  180
LKKVYEARNT NEENVASNLS CTIRNGYDLH APISLQLSQP QPQYSEPATK AVKLGYSLKL  240
IMYSI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D2e-20274173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-20274173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-20274173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A2e-20274173MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J3e-20274173Myocyte-specific enhancer factor 2A
3p57_I3e-20274173Myocyte-specific enhancer factor 2A
3p57_D3e-20274173Myocyte-specific enhancer factor 2A
3p57_C3e-20274173Myocyte-specific enhancer factor 2A
3p57_B3e-20274173Myocyte-specific enhancer factor 2A
3p57_A3e-20274173Myocyte-specific enhancer factor 2A
3kov_J3e-20274173Myocyte-specific enhancer factor 2A
3kov_I3e-20274173Myocyte-specific enhancer factor 2A
3kov_B3e-20274173Myocyte-specific enhancer factor 2A
3kov_A3e-20274173Myocyte-specific enhancer factor 2A
1tqe_S4e-20174174Myocyte-specific enhancer factor 2B
1tqe_R4e-20174174Myocyte-specific enhancer factor 2B
1tqe_Q4e-20174174Myocyte-specific enhancer factor 2B
1tqe_P4e-20174174Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004485623.10.0PREDICTED: MADS-box transcription factor 23-like
SwissprotQ6EP491e-101MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLG7IS851e-165G7IS85_MEDTR; MADS-box transcription factor
STRINGGLYMA13G32810.11e-147(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF8912560
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.15e-94AGAMOUS-like 21